PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g61760.1.p
Common NameBRADI_2g61760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 331aa    MW: 36713.3 Da    PI: 4.6814
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g61760.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.34.2e-25183232352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       +++ l++l++yF++p+++AA+eL+v++T+LK++CR++G++RWPhRk+ksl
  Bradi2g61760.1.p 183 QHVGLDELRRYFYMPMTKAAQELNVGTTALKKRCRELGVARWPHRKMKSL 232
                       678899******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.848164253IPR003035RWP-RK domain
PfamPF020421.5E-21185232IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQYYVNNGDI WCDHQQQLAA FPFSSSSPPP PGLAELADYC SSDLNLSPLS WEEEEEATRS  60
AACYLPSPMF PAADDLPPFP PTADDDVLMP DLEPFLQALG NELVVDNGAA PILPVAMDHP  120
IETTTQQPLQ INDRHDDDGS LSGGYDETAA AEQQRCAFAR PPAVEKKKKK RGDGPAAGGR  180
SLQHVGLDEL RRYFYMPMTK AAQELNVGTT ALKKRCRELG VARWPHRKMK SLRSLISNLQ  240
EMGNGMSLPP LEAVQEELEV CCAMMEQNPG IELSESTKKL RQACFKESYN RRRFVDAATT  300
TVSMLEYGQC CSYYPFSSFS HQQFSSYHNT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039336e-32AP003933.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0066C06.
GenBankAP0042586e-32AP004258.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0024F24.
GenBankAP0149576e-32AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126096e-32CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1HVI20.0I1HVI2_BRADI; Uncharacterized protein
STRINGBRADI2G61760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-35RWP-RK domain-containing protein